Lineage for d2yhfe_ (2yhf E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443240Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1443241Protein automated matches [190159] (8 species)
    not a true protein
  7. 1443271Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries)
  8. 1443374Domain d2yhfe_: 2yhf E: [198759]
    automated match to d2yhfi_

Details for d2yhfe_

PDB Entry: 2yhf (more details), 1.9 Å

PDB Description: 1.9 angstrom crystal structure of clec5a
PDB Compounds: (E:) c-type lectin domain family 5 member a

SCOPe Domain Sequences for d2yhfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yhfe_ d.169.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

SCOPe Domain Coordinates for d2yhfe_:

Click to download the PDB-style file with coordinates for d2yhfe_.
(The format of our PDB-style files is described here.)

Timeline for d2yhfe_: