SCOPe 2.06: Domain d2yhfd_: 2yhf D:

Lineage for d2yhfd_ (2yhf D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)

8. Domain d2yhfd_: 2yhf D: [198758]
   automated match to d2yhfi_

Details for d2yhfd_

PDB Entry: 2yhf, 1.9 Å

PDB Description: 1.9 angstrom crystal structure of clec5a

PDB Compounds: (D:) c-type lectin domain family 5 member a

SCOPe Domain Sequences for d2yhfd_:

Sequence; same for both SEQRES and ATOM records:

>d2yhfd_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

Timeline for d2yhfd_:

• d2yhfd_ first appeared in SCOPe 2.03
  
• d2yhfd_ appears in SCOPe 2.05
  
• d2yhfd_ appears in SCOPe 2.07
  
• d2yhfd_ appears in the current release, SCOPe 2.08