Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries) |
Domain d2yhfd_: 2yhf D: [198758] automated match to d2yhfi_ |
PDB Entry: 2yhf (more details), 1.9 Å
SCOPe Domain Sequences for d2yhfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yhfd_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna
Timeline for d2yhfd_: