Lineage for d2yhfc_ (2yhf C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002461Domain d2yhfc_: 2yhf C: [198757]
    automated match to d2yhfi_

Details for d2yhfc_

PDB Entry: 2yhf (more details), 1.9 Å

PDB Description: 1.9 angstrom crystal structure of clec5a
PDB Compounds: (C:) c-type lectin domain family 5 member a

SCOPe Domain Sequences for d2yhfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yhfc_ d.169.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

SCOPe Domain Coordinates for d2yhfc_:

Click to download the PDB-style file with coordinates for d2yhfc_.
(The format of our PDB-style files is described here.)

Timeline for d2yhfc_: