Lineage for d1ggbh1 (1ggb H:1-112)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102469Species Fab 50.1 (mouse), kappa L chain [48772] (3 PDB entries)
  8. 102470Domain d1ggbh1: 1ggb H:1-112 [19875]
    Other proteins in same PDB: d1ggbh2, d1ggbl2

Details for d1ggbh1

PDB Entry: 1ggb (more details), 2.8 Å

PDB Description: major antigen-induced domain rearrangements in an antibody

SCOP Domain Sequences for d1ggbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggbh1 b.1.1.1 (H:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 50.1 (mouse), kappa L chain}
qvqlqesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvs

SCOP Domain Coordinates for d1ggbh1:

Click to download the PDB-style file with coordinates for d1ggbh1.
(The format of our PDB-style files is described here.)

Timeline for d1ggbh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ggbh2