SCOPe 2.04: Domain d2yfji2: 2yfj I:180-459

Lineage for d2yfji2 (2yfj I:180-459)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (19 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226024] (7 PDB entries)

8. Domain d2yfji2: 2yfj I:180-459 [198739]
   Other proteins in same PDB: d2yfja1, d2yfjb_, d2yfjc1, d2yfjd_, d2yfje1, d2yfjf_, d2yfjg1, d2yfjh_, d2yfji1, d2yfjj_, d2yfjk1, d2yfjl_
   automated match to d1wqla2
   complexed with 1it, fe2, fes

Details for d2yfji2

PDB Entry: 2yfj, 2.15 Å

PDB Description: crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran

PDB Compounds: (I:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yfji2:

Sequence; same for both SEQRES and ATOM records:

>d2yfji2 d.129.3.0 (I:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnqirvwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqpfnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

Timeline for d2yfji2:

• d2yfji2 first appeared in SCOPe 2.03
  
• d2yfji2 appears in SCOPe 2.05
  
• d2yfji2 appears in the current release, SCOPe 2.08