Lineage for d2yfje2 (2yfj E:180-459)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975906Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2975907Protein automated matches [190218] (21 species)
    not a true protein
  7. 2975910Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)
  8. 2975919Domain d2yfje2: 2yfj E:180-459 [198735]
    Other proteins in same PDB: d2yfja1, d2yfjb_, d2yfjc1, d2yfjd_, d2yfje1, d2yfjf_, d2yfjg1, d2yfjh_, d2yfji1, d2yfjj_, d2yfjk1, d2yfjl_
    automated match to d1wqla2
    complexed with 1it, fe2, fes

Details for d2yfje2

PDB Entry: 2yfj (more details), 2.15 Å

PDB Description: crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran
PDB Compounds: (E:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yfje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfje2 d.129.3.0 (E:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnqirvwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqpfnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

SCOPe Domain Coordinates for d2yfje2:

Click to download the PDB-style file with coordinates for d2yfje2.
(The format of our PDB-style files is described here.)

Timeline for d2yfje2: