Lineage for d2yfjc1 (2yfj C:18-179)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045320Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2045321Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2045541Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2045542Protein automated matches [190701] (11 species)
    not a true protein
  7. 2045548Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries)
  8. 2045556Domain d2yfjc1: 2yfj C:18-179 [198732]
    Other proteins in same PDB: d2yfja2, d2yfjb_, d2yfjc2, d2yfjd_, d2yfje2, d2yfjf_, d2yfjg2, d2yfjh_, d2yfji2, d2yfjj_, d2yfjk2, d2yfjl_
    automated match to d1wqla1
    complexed with 1it, fe2, fes

Details for d2yfjc1

PDB Entry: 2yfj (more details), 2.15 Å

PDB Description: crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran
PDB Compounds: (C:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yfjc1:

Sequence, based on SEQRES records: (download)

>d2yfjc1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records): (download)

>d2yfjc1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

SCOPe Domain Coordinates for d2yfjc1:

Click to download the PDB-style file with coordinates for d2yfjc1.
(The format of our PDB-style files is described here.)

Timeline for d2yfjc1: