SCOPe 2.08: Domain d2yfjc1: 2yfj C:18-179

Lineage for d2yfjc1 (2yfj C:18-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (13 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries)

8. Domain d2yfjc1: 2yfj C:18-179 [198732]
   Other proteins in same PDB: d2yfja2, d2yfjb_, d2yfjc2, d2yfjd_, d2yfje2, d2yfjf_, d2yfjg2, d2yfjh_, d2yfji2, d2yfjj_, d2yfjk2, d2yfjl_
   automated match to d1wqla1
   complexed with 1it, fe2, fes

Details for d2yfjc1

PDB Entry: 2yfj, 2.15 Å

PDB Description: crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran

PDB Compounds: (C:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yfjc1:

Sequence, based on SEQRES records:

>d2yfjc1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records):

>d2yfjc1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

Timeline for d2yfjc1:

• d2yfjc1 first appeared in SCOPe 2.03
  
• d2yfjc1 appears in SCOPe 2.07