| Class b: All beta proteins [48724] (180 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
| Protein automated matches [190701] (13 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries) |
| Domain d2yfjc1: 2yfj C:18-179 [198732] Other proteins in same PDB: d2yfja2, d2yfjb_, d2yfjc2, d2yfjd_, d2yfje2, d2yfjf_, d2yfjg2, d2yfjh_, d2yfji2, d2yfjj_, d2yfjk2, d2yfjl_ automated match to d1wqla1 complexed with 1it, fe2, fes |
PDB Entry: 2yfj (more details), 2.15 Å
SCOPe Domain Sequences for d2yfjc1:
Sequence, based on SEQRES records: (download)
>d2yfjc1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq
>d2yfjc1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq
Timeline for d2yfjc1: