Lineage for d2yfig2 (2yfi G:180-459)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1669085Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1669378Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1669379Protein automated matches [190218] (19 species)
    not a true protein
  7. 1669382Species Burkholderia xenovorans [TaxId:266265] [226024] (7 PDB entries)
  8. 1669386Domain d2yfig2: 2yfi G:180-459 [198725]
    Other proteins in same PDB: d2yfia1, d2yfib_, d2yfic1, d2yfid_, d2yfie1, d2yfif_, d2yfig1, d2yfih_, d2yfii1, d2yfij_, d2yfik1, d2yfil_
    automated match to d1wqla2
    complexed with fe2, fes

Details for d2yfig2

PDB Entry: 2yfi (more details), 2.15 Å

PDB Description: crystal structure of biphenyl dioxygenase variant rr41 (bpdo-rr41)
PDB Compounds: (G:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yfig2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfig2 d.129.3.0 (G:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnqirvwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqpfnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

SCOPe Domain Coordinates for d2yfig2:

Click to download the PDB-style file with coordinates for d2yfig2.
(The format of our PDB-style files is described here.)

Timeline for d2yfig2: