SCOPe 2.04: Domain d2yfie2: 2yfi E:180-468

Lineage for d2yfie2 (2yfi E:180-468)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (19 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226024] (7 PDB entries)

8. Domain d2yfie2: 2yfi E:180-468 [198723]
   Other proteins in same PDB: d2yfia1, d2yfib_, d2yfic1, d2yfid_, d2yfie1, d2yfif_, d2yfig1, d2yfih_, d2yfii1, d2yfij_, d2yfik1, d2yfil_
   automated match to d1wqla2
   complexed with fe2, fes

Details for d2yfie2

PDB Entry: 2yfi, 2.15 Å

PDB Description: crystal structure of biphenyl dioxygenase variant rr41 (bpdo-rr41)

PDB Compounds: (E:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yfie2:

Sequence; same for both SEQRES and ATOM records:

>d2yfie2 d.129.3.0 (E:180-468) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnqirvwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqpfnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

Timeline for d2yfie2:

• d2yfie2 first appeared in SCOPe 2.03
  
• d2yfie2 appears in SCOPe 2.05
  
• d2yfie2 appears in the current release, SCOPe 2.08