SCOP 1.63: Domain d1fvec1: 1fve C:1-107

Lineage for d1fvec1 (1fve C:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Herceptin Fab 4D5 (synthetic, humanised version), kappa L chain [48771] (4 PDB entries)

8. Domain d1fvec1: 1fve C:1-107 [19872]
   Other proteins in same PDB: d1fvea2, d1fveb2, d1fvec2, d1fved2

Details for d1fvec1

PDB Entry: 1fve, 2.7 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvec1:

Sequence; same for both SEQRES and ATOM records:

>d1fvec1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Herceptin Fab 4D5 (synthetic, humanised version), kappa L chain}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik

Timeline for d1fvec1:

• d1fvec1 first appeared (with stable ids) in SCOP 1.55
  
• d1fvec1 appears in SCOP 1.61
  
• d1fvec1 appears in SCOP 1.65
  
• d1fvec1 appears in the current release, SCOPe 2.08