Lineage for d2yfia1 (2yfi A:18-179)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053226Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2053227Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2053448Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2053449Protein automated matches [190701] (11 species)
    not a true protein
  7. 2053455Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries)
  8. 2053456Domain d2yfia1: 2yfi A:18-179 [198718]
    Other proteins in same PDB: d2yfia2, d2yfib_, d2yfic2, d2yfid_, d2yfie2, d2yfif_, d2yfig2, d2yfih_, d2yfii2, d2yfij_, d2yfik2, d2yfil_
    automated match to d1wqla1
    complexed with fe2, fes

Details for d2yfia1

PDB Entry: 2yfi (more details), 2.15 Å

PDB Description: crystal structure of biphenyl dioxygenase variant rr41 (bpdo-rr41)
PDB Compounds: (A:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yfia1:

Sequence, based on SEQRES records: (download)

>d2yfia1 b.33.1.0 (A:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records): (download)

>d2yfia1 b.33.1.0 (A:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

SCOPe Domain Coordinates for d2yfia1:

Click to download the PDB-style file with coordinates for d2yfia1.
(The format of our PDB-style files is described here.)

Timeline for d2yfia1: