SCOPe 2.03: Domain d2yf6a1: 2yf6 A:1-177

Lineage for d2yf6a1 (2yf6 A:1-177)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225828] (8 PDB entries)

8. Domain d2yf6a1: 2yf6 A:1-177 [198716]
   Other proteins in same PDB: d2yf6a2, d2yf6b_
   automated match to d1de4a2

Details for d2yf6a1

PDB Entry: 2yf6, 2.8 Å

PDB Description: complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide

PDB Compounds: (A:) Major histocompatibility complex class I glycoprotein haplotype B21

SCOPe Domain Sequences for d2yf6a1:

Sequence; same for both SEQRES and ATOM records:

>d2yf6a1 d.19.1.0 (A:1-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elhtlryirtamtdpgpglpwfvdvgyvdgelfmhynstarravprtewiaantdqqywd
retqivqgseqinrenldilrrrynqtggshtvqwmsgcdiledgtirgyhqaaydgrdf
vafdkgtmtltaavpeavptkrkweeggyaeglkqyleetcvewlrryveygkaelg

Timeline for d2yf6a1:

• d2yf6a1 is new in SCOPe 2.03-stable
  
• d2yf6a1 appears in SCOPe 2.04
  
• d2yf6a1 last appears in SCOPe 2.05