| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
| Protein automated matches [190615] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries) |
| Domain d2yemb_: 2yem B: [198713] automated match to d2yema_ complexed with wsh |
PDB Entry: 2yem (more details), 2.3 Å
SCOPe Domain Sequences for d2yemb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yemb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd
Timeline for d2yemb_: