SCOPe 2.06: Domain d2ybrh_: 2ybr H:

Lineage for d2ybrh_ (2ybr H:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d2ybrh_: 2ybr H: [198707]
   Other proteins in same PDB: d2ybra_, d2ybrc_, d2ybrd_, d2ybrf_, d2ybrg_, d2ybri_
   automated match to d4jvpa_

Details for d2ybrh_

PDB Entry: 2ybr, 2.55 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann

PDB Compounds: (H:) single chain antibody fragment 9004g

SCOPe Domain Sequences for d2ybrh_:

Sequence; same for both SEQRES and ATOM records:

>d2ybrh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sggggseivltqspatlsvspgeratlscrasqsvrsylawyqqkpgqaprllfsdasnr
atgiparftgsgsgtdftltisslepedfaiyycqqyrysprtfgqgtkveikr

Timeline for d2ybrh_:

• d2ybrh_ first appeared in SCOPe 2.03
  
• d2ybrh_ appears in SCOPe 2.05
  
• d2ybrh_ appears in SCOPe 2.07
  
• d2ybrh_ appears in the current release, SCOPe 2.08, called d2ybrh1