Lineage for d2ybrh_ (2ybr H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356018Domain d2ybrh_: 2ybr H: [198707]
    Other proteins in same PDB: d2ybra_, d2ybrb2, d2ybrc_, d2ybrd_, d2ybrf_, d2ybrg_, d2ybri_
    automated match to d4jvpa_

Details for d2ybrh_

PDB Entry: 2ybr (more details), 2.55 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
PDB Compounds: (H:) single chain antibody fragment 9004g

SCOPe Domain Sequences for d2ybrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ybrh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sggggseivltqspatlsvspgeratlscrasqsvrsylawyqqkpgqaprllfsdasnr
atgiparftgsgsgtdftltisslepedfaiyycqqyrysprtfgqgtkveikr

SCOPe Domain Coordinates for d2ybrh_:

Click to download the PDB-style file with coordinates for d2ybrh_.
(The format of our PDB-style files is described here.)

Timeline for d2ybrh_: