![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1489 PDB entries) |
![]() | Domain d2ybre_: 2ybr E: [198705] Other proteins in same PDB: d2ybra_, d2ybrb2, d2ybrc_, d2ybrd_, d2ybrf_, d2ybrg_, d2ybri_ automated match to d4jvpa_ |
PDB Entry: 2ybr (more details), 2.55 Å
SCOPe Domain Sequences for d2ybre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ybre_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} seivltqspatlsvspgeratlscrasqsvrsylawyqqkpgqaprllfsdasnratgip arftgsgsgtdftltisslepedfaiyycqqyrysprtfgqgtkvei
Timeline for d2ybre_: