Lineage for d2ybrd_ (2ybr D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742637Domain d2ybrd_: 2ybr D: [198704]
    Other proteins in same PDB: d2ybrb1, d2ybrb2, d2ybrc_, d2ybre1, d2ybre2, d2ybrf_, d2ybrh1, d2ybrh2, d2ybri_
    automated match to d3ogoh_

Details for d2ybrd_

PDB Entry: 2ybr (more details), 2.55 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
PDB Compounds: (D:) single chain antibody fragment 9004g

SCOPe Domain Sequences for d2ybrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ybrd_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlsctgsgftfdnyamhwlrqvpgeglewvsgisrssgdidy
adsvkgrftisrddakktlslqmnslraedtavyycarggvgsfdtwgqgtmvtv

SCOPe Domain Coordinates for d2ybrd_:

Click to download the PDB-style file with coordinates for d2ybrd_.
(The format of our PDB-style files is described here.)

Timeline for d2ybrd_: