SCOPe 2.08: Domain d2ybrb1: 2ybr B:133-239

Lineage for d2ybrb1 (2ybr B:133-239)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2ybrb1: 2ybr B:133-239 [198703]
   Other proteins in same PDB: d2ybra_, d2ybrb2, d2ybrc_, d2ybrd_, d2ybre2, d2ybrf_, d2ybrg_, d2ybrh2, d2ybri_
   automated match to d4jvpa_

Details for d2ybrb1

PDB Entry: 2ybr, 2.55 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann

PDB Compounds: (B:) single chain antibody fragment 9004g

SCOPe Domain Sequences for d2ybrb1:

Sequence; same for both SEQRES and ATOM records:

>d2ybrb1 b.1.1.0 (B:133-239) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlsvspgeratlscrasqsvrsylawyqqkpgqaprllfsdasnratgipa
rftgsgsgtdftltisslepedfaiyycqqyrysprtfgqgtkveik

Timeline for d2ybrb1:

• d2ybrb1 first appeared in SCOPe 2.03, called d2ybrb_
  
• d2ybrb1 appears in SCOPe 2.07