Lineage for d2ya3e2 (2ya3 E:182-324)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409742Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1409743Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1409744Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1409745Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 1409746Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (7 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 1409752Domain d2ya3e2: 2ya3 E:182-324 [198696]
    Other proteins in same PDB: d2ya3a_, d2ya3b_
    automated match to d2v8qe1
    complexed with amp, j7v

Details for d2ya3e2

PDB Entry: 2ya3 (more details), 2.5 Å

PDB Description: structure of the regulatory fragment of mammalian ampk in complex with coumarin adp
PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d2ya3e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ya3e2 d.37.1.1 (E:182-324) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlvv
vdehdvvkgivslsdilqalvlt

SCOPe Domain Coordinates for d2ya3e2:

Click to download the PDB-style file with coordinates for d2ya3e2.
(The format of our PDB-style files is described here.)

Timeline for d2ya3e2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ya3e1