Lineage for d2y91a_ (2y91 A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450662Protein automated matches [190161] (19 species)
    not a true protein
  7. 1450665Species Bacillus licheniformis [TaxId:1402] [188244] (6 PDB entries)
  8. 1450670Domain d2y91a_: 2y91 A: [198694]
    automated match to d2y91b_
    complexed with 98j, cit, pge

Details for d2y91a_

PDB Entry: 2y91 (more details), 2 Å

PDB Description: Crystal structure of class A beta-lactamase from Bacillus licheniformis BS3 with clavulanic acid
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2y91a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y91a_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
kddfakleeqfdaklgifaldtgtnrtvtyrpderfafaxtikaltvgvllqqksiedln
qritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkel
rkigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmk
rnttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdaky
ddkliaeatkvvvkaln

SCOPe Domain Coordinates for d2y91a_:

Click to download the PDB-style file with coordinates for d2y91a_.
(The format of our PDB-style files is described here.)

Timeline for d2y91a_: