Lineage for d2y8qe1 (2y8q E:23-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187447Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2187448Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2187449Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2187450Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 2187451Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (10 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 2187460Domain d2y8qe1: 2y8q E:23-181 [198691]
    Other proteins in same PDB: d2y8qa1, d2y8qa2, d2y8qa3, d2y8qb_
    automated match to d2v8qe2
    complexed with adp, amp

Details for d2y8qe1

PDB Entry: 2y8q (more details), 2.8 Å

PDB Description: Structure of the regulatory fragment of mammalian AMPK in complex with one ADP
PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d2y8qe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y8qe1 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snssvyttfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfv
gmltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavs
slirnkihrlpvidpesgntlyilthkrilkflklfite

SCOPe Domain Coordinates for d2y8qe1:

Click to download the PDB-style file with coordinates for d2y8qe1.
(The format of our PDB-style files is described here.)

Timeline for d2y8qe1: