SCOPe 2.03: Domain d2y8qe1: 2y8q E:23-181

Lineage for d2y8qe1 (2y8q E:23-181)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (7 PDB entries)
   Uniprot P80385 182-326! Uniprot P80385 23-181

8. Domain d2y8qe1: 2y8q E:23-181 [198691]
   Other proteins in same PDB: d2y8qa_, d2y8qb_
   automated match to d2v8qe2
   complexed with adp, amp

Details for d2y8qe1

PDB Entry: 2y8q, 2.8 Å

PDB Description: Structure of the regulatory fragment of mammalian AMPK in complex with one ADP

PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d2y8qe1:

Sequence; same for both SEQRES and ATOM records:

>d2y8qe1 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snssvyttfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfv
gmltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavs
slirnkihrlpvidpesgntlyilthkrilkflklfite

Timeline for d2y8qe1:

• d2y8qe1 is new in SCOPe 2.03-stable
  
• d2y8qe1 appears in SCOPe 2.04
  
• d2y8qe1 appears in the current release, SCOPe 2.08