Lineage for d2y8le2 (2y8l E:182-327)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187447Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2187448Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2187449Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2187450Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 2187451Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (10 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 2187463Domain d2y8le2: 2y8l E:182-327 [198690]
    Other proteins in same PDB: d2y8la1, d2y8la2, d2y8la3, d2y8lb_
    automated match to d2v8qe1
    complexed with adp, amp

Details for d2y8le2

PDB Entry: 2y8l (more details), 2.5 Å

PDB Description: Structure of an active form of mammalian AMPK in complex with two ADP
PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d2y8le2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y8le2 d.37.1.1 (E:182-327) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlvv
vdehdvvkgivslsdilqalvltgge

SCOPe Domain Coordinates for d2y8le2:

Click to download the PDB-style file with coordinates for d2y8le2.
(The format of our PDB-style files is described here.)

Timeline for d2y8le2: