![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein automated matches [190140] (37 species) not a true protein |
![]() | Species Burkholderia sp. [TaxId:233098] [190010] (5 PDB entries) |
![]() | Domain d2y84e_: 2y84 E: [198685] automated match to d2y84h_ complexed with gol |
PDB Entry: 2y84 (more details), 2.8 Å
SCOPe Domain Sequences for d2y84e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y84e_ c.94.1.1 (E:) automated matches {Burkholderia sp. [TaxId: 233098]} sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghge vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl pdiainlfwhakynrdpgnmwlrqlfvelfse
Timeline for d2y84e_: