Lineage for d1fvdc1 (1fvd C:1-114)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52102Species Fab 4D5 (synthetic, humanised version), kappa L chain [48771] (3 PDB entries)
  8. 52109Domain d1fvdc1: 1fvd C:1-114 [19868]
    Other proteins in same PDB: d1fvda2, d1fvdb2, d1fvdc2, d1fvdd2

Details for d1fvdc1

PDB Entry: 1fvd (more details), 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvdc1 b.1.1.1 (C:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikrtvaaps

SCOP Domain Coordinates for d1fvdc1:

Click to download the PDB-style file with coordinates for d1fvdc1.
(The format of our PDB-style files is described here.)

Timeline for d1fvdc1: