SCOPe 2.06: Domain d2y6pb_: 2y6p B:

Lineage for d2y6pb_ (2y6p B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.0: automated matches [191551] (1 protein)
   not a true family

6. Protein automated matches [190951] (26 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [196205] (1 PDB entry)

8. Domain d2y6pb_: 2y6p B: [198675]
   automated match to d2y6pc_
   complexed with bme, ctp, ipa, mg

Details for d2y6pb_

PDB Entry: 2y6p, 2.1 Å

PDB Description: evidence for a two-metal-ion-mechanism in the kdo- cytidylyltransferase kdsb

PDB Compounds: (B:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d2y6pb_:

Sequence; same for both SEQRES and ATOM records:

>d2y6pb_ c.68.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
rraviiparlgstrlkekplknllgkplirwvveglvktgervilatdservkevvedlc
evfltpsdlpsgsdrvlyvvrdldvdliinyqgdepfvyeediklifrelekgervvtla
rkdkeayerpedvkvvldregyalyfsrspipyfrkndtfyplkhvgiygfrketlmefg
amppskleqiegleqlrllengikikvlitenyyhgvdteedlkiveeklknl

Timeline for d2y6pb_:

• d2y6pb_ first appeared in SCOPe 2.03
  
• d2y6pb_ appears in SCOPe 2.05
  
• d2y6pb_ appears in SCOPe 2.07
  
• d2y6pb_ appears in the current release, SCOPe 2.08