![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
![]() | Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81454] (24 PDB entries) |
![]() | Domain d2y69o1: 2y69 O:2-90 [198671] Other proteins in same PDB: d2y69a_, d2y69b2, d2y69c_, d2y69d_, d2y69g_, d2y69h_, d2y69i_, d2y69l_, d2y69n_, d2y69o2, d2y69p_, d2y69q_, d2y69t_, d2y69u_, d2y69v_, d2y69y_ automated match to d1v54b2 complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn |
PDB Entry: 2y69 (more details), 1.95 Å
SCOPe Domain Sequences for d2y69o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y69o1 f.17.2.1 (O:2-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} aypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqev etiwtilpaiililialpslrilymmdei
Timeline for d2y69o1: