Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) automatically mapped to Pfam PF02936 |
Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins) |
Protein automated matches [190270] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187062] (17 PDB entries) |
Domain d2y69d_: 2y69 D: [198670] Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69g_, d2y69h_, d2y69i_, d2y69l_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69t_, d2y69u_, d2y69v_, d2y69y_ automated match to d1v54d_ complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn |
PDB Entry: 2y69 (more details), 1.95 Å
SCOPe Domain Sequences for d2y69d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y69d_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]} svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm ldmkvapiqgfsakwdydknewkk
Timeline for d2y69d_: