Lineage for d1fvdb1 (1fvd B:1-120)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510451Species Engineered (including hybrid species) [88562] (68 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 1510488Domain d1fvdb1: 1fvd B:1-120 [19867]
    Other proteins in same PDB: d1fvda1, d1fvda2, d1fvdb2, d1fvdc1, d1fvdc2, d1fvdd2
    part of humanized Fab 4D5, herceptin

Details for d1fvdb1

PDB Entry: 1fvd (more details), 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling
PDB Compounds: (B:) igg1-kappa 4d5 fab (heavy chain)

SCOPe Domain Sequences for d1fvdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvdb1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytry
adsvkgrftisadtskntlylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvss

SCOPe Domain Coordinates for d1fvdb1:

Click to download the PDB-style file with coordinates for d1fvdb1.
(The format of our PDB-style files is described here.)

Timeline for d1fvdb1: