SCOP 1.61: Domain d1fvdb1: 1fvd B:1-120

Lineage for d1fvdb1 (1fvd B:1-120)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
Species Fab 4D5 (synthetic, humanised version), kappa L chain [48771] (3 PDB entries)
Domain d1fvdb1: 1fvd B:1-120 [19867]
Other proteins in same PDB: d1fvda2, d1fvdb2, d1fvdc2, d1fvdd2

Details for d1fvdb1

PDB Entry: 1fvd (more details), 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvdb1 b.1.1.1 (B:1-120) Immunoglobulin (variable domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain}
evqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytry
adsvkgrftisadtskntlylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvss

SCOP Domain Coordinates for d1fvdb1:

Click to download the PDB-style file with coordinates for d1fvdb1.
(The format of our PDB-style files is described here.)

Timeline for d1fvdb1: