Lineage for d2xv6c_ (2xv6 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706466Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 2706520Protein automated matches [226861] (4 species)
    not a true protein
  7. 2706524Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (6 PDB entries)
  8. 2706533Domain d2xv6c_: 2xv6 C: [198665]
    Other proteins in same PDB: d2xv6b1, d2xv6b2, d2xv6d1, d2xv6d2
    automated match to d1baja_

Details for d2xv6c_

PDB Entry: 2xv6 (more details), 1.89 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain (146- 220) in complex with a camelid vhh.
PDB Compounds: (C:) capsid protein p24

SCOPe Domain Sequences for d2xv6c_:

Sequence, based on SEQRES records: (download)

>d2xv6c_ a.28.3.1 (C:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtac

Sequence, based on observed residues (ATOM records): (download)

>d2xv6c_ a.28.3.1 (C:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalat
leemmtac

SCOPe Domain Coordinates for d2xv6c_:

Click to download the PDB-style file with coordinates for d2xv6c_.
(The format of our PDB-style files is described here.)

Timeline for d2xv6c_: