![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
![]() | Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) |
![]() | Protein automated matches [226861] (2 species) not a true protein |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (3 PDB entries) |
![]() | Domain d2xv6a_: 2xv6 A: [198664] Other proteins in same PDB: d2xv6b_, d2xv6d_ automated match to d1baja_ |
PDB Entry: 2xv6 (more details), 1.89 Å
SCOPe Domain Sequences for d2xv6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xv6a_ a.28.3.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} sptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkal gpgatleemmtacqg
Timeline for d2xv6a_: