SCOPe 2.05: Domain d2xt1a_: 2xt1 A:

Lineage for d2xt1a_ (2xt1 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein automated matches [226861] (3 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (6 PDB entries)

8. Domain d2xt1a_: 2xt1 A: [198662]
   Other proteins in same PDB: d2xt1b_
   automated match to d1baja_
   complexed with gol

Details for d2xt1a_

PDB Entry: 2xt1, 1.32 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain (146- 231) in complex with a camelid vhh.

PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d2xt1a_:

Sequence; same for both SEQRES and ATOM records:

>d2xt1a_ a.28.3.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
sptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkal
gpgatleemmtacqgvggpghkarvl

Timeline for d2xt1a_:

• d2xt1a_ first appeared in SCOPe 2.03
  
• d2xt1a_ appears in SCOPe 2.04
  
• d2xt1a_ appears in SCOPe 2.06
  
• d2xt1a_ appears in the current release, SCOPe 2.08