SCOP 1.55: Domain d1fvda1: 1fvd A:1-108

Lineage for d1fvda1 (1fvd A:1-108)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 4D5 (synthetic, humanised version), kappa L chain [48771] (3 PDB entries)

8. Domain d1fvda1: 1fvd A:1-108 [19866]
   Other proteins in same PDB: d1fvda2, d1fvdb2, d1fvdc2, d1fvdd2

Details for d1fvda1

PDB Entry: 1fvd, 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvda1:

Sequence; same for both SEQRES and ATOM records:

>d1fvda1 b.1.1.1 (A:1-108) Immunoglobulin (variable domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikr

Timeline for d1fvda1:

• d1fvda1 appears in SCOP 1.57
  
• d1fvda1 appears in the current release, SCOPe 2.08