Lineage for d1fvda1 (1fvd A:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740697Species Engineered (including hybrid species) [88533] (60 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2740757Domain d1fvda1: 1fvd A:1-107 [19866]
    Other proteins in same PDB: d1fvda2, d1fvdb1, d1fvdb2, d1fvdc2, d1fvdd1, d1fvdd2
    part of humanized Fab 4D5, herceptin

Details for d1fvda1

PDB Entry: 1fvd (more details), 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling
PDB Compounds: (A:) igg1-kappa 4d5 fab (light chain)

SCOPe Domain Sequences for d1fvda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvda1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik

SCOPe Domain Coordinates for d1fvda1:

Click to download the PDB-style file with coordinates for d1fvda1.
(The format of our PDB-style files is described here.)

Timeline for d1fvda1: