SCOPe 2.08: Domain d1fvda1: 1fvd A:1-107

Lineage for d1fvda1 (1fvd A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (60 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody

8. Domain d1fvda1: 1fvd A:1-107 [19866]
   Other proteins in same PDB: d1fvda2, d1fvdb1, d1fvdb2, d1fvdc2, d1fvdd1, d1fvdd2
   part of humanized Fab 4D5, herceptin

Details for d1fvda1

PDB Entry: 1fvd, 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

PDB Compounds: (A:) igg1-kappa 4d5 fab (light chain)

SCOPe Domain Sequences for d1fvda1:

Sequence; same for both SEQRES and ATOM records:

>d1fvda1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik

Timeline for d1fvda1:

• d1fvda1 first appeared (with stable ids) in SCOP 1.55
  
• d1fvda1 appears in SCOPe 2.07