SCOPe 2.03: Domain d2xrxu1: 2xrx U:18-179

Lineage for d2xrxu1 (2xrx U:18-179)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (8 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226023] (6 PDB entries)

8. Domain d2xrxu1: 2xrx U:18-179 [198658]
   Other proteins in same PDB: d2xrxa2, d2xrxb_, d2xrxc2, d2xrxd_, d2xrxe2, d2xrxf_, d2xrxg2, d2xrxh_, d2xrxi2, d2xrxj_, d2xrxk2, d2xrxl_, d2xrxm2, d2xrxn_, d2xrxo2, d2xrxp_, d2xrxq2, d2xrxr_, d2xrxs2, d2xrxt_, d2xrxu2, d2xrxv_, d2xrxw2, d2xrxx_
   automated match to d1wqla1
   complexed with bnl, fe2, fes

Details for d2xrxu1

PDB Entry: 2xrx, 2.42 Å

PDB Description: crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400

PDB Compounds: (U:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xrxu1:

Sequence, based on SEQRES records:

>d2xrxu1 b.33.1.0 (U:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records):

>d2xrxu1 b.33.1.0 (U:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafdkaewgplqarvatykglvfanwdvq

Timeline for d2xrxu1:

• d2xrxu1 is new in SCOPe 2.03-stable
  
• d2xrxu1 appears in SCOPe 2.04
  
• d2xrxu1 appears in the current release, SCOPe 2.08