Lineage for d1fvcc_ (1fvc C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288591Species Engineered (including hybrid species) [88533] (61 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 1288616Domain d1fvcc_: 1fvc C: [19864]
    Other proteins in same PDB: d1fvcb_, d1fvcd_
    part of humanized Fv 4D5, herceptin

Details for d1fvcc_

PDB Entry: 1fvc (more details), 2.2 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling
PDB Compounds: (C:) igg1-kappa 4d5 fv (light chain)

SCOPe Domain Sequences for d1fvcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvcc_ b.1.1.1 (C:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflysgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikr

SCOPe Domain Coordinates for d1fvcc_:

Click to download the PDB-style file with coordinates for d1fvcc_.
(The format of our PDB-style files is described here.)

Timeline for d1fvcc_: