Lineage for d1fvca_ (1fvc A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7436Species Fab 4D5 (synthetic, humanised version), kappa L chain [48771] (3 PDB entries)
  8. 7437Domain d1fvca_: 1fvc A: [19862]

Details for d1fvca_

PDB Entry: 1fvc (more details), 2.2 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvca_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflysgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikrt

SCOP Domain Coordinates for d1fvca_:

Click to download the PDB-style file with coordinates for d1fvca_.
(The format of our PDB-style files is described here.)

Timeline for d1fvca_: