Lineage for d2xr8c1 (2xr8 C:18-179)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1783175Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 1783176Protein automated matches [190701] (10 species)
    not a true protein
  7. 1783182Species Burkholderia xenovorans [TaxId:266265] [226023] (7 PDB entries)
  8. 1783214Domain d2xr8c1: 2xr8 C:18-179 [198616]
    Other proteins in same PDB: d2xr8a2, d2xr8b_, d2xr8c2, d2xr8d_, d2xr8e2, d2xr8f_, d2xr8g2, d2xr8h_, d2xr8i2, d2xr8j_, d2xr8k2, d2xr8l_, d2xr8m2, d2xr8n_, d2xr8o2, d2xr8p_, d2xr8q2, d2xr8r_, d2xr8s2, d2xr8t_, d2xr8u2, d2xr8v_, d2xr8w2, d2xr8x_
    automated match to d1wqla1
    complexed with fe2, fes

Details for d2xr8c1

PDB Entry: 2xr8 (more details), 2.49 Å

PDB Description: crystal structure of biphenyl dioxygenase from burkholderia xenovorans lb400
PDB Compounds: (C:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xr8c1:

Sequence, based on SEQRES records: (download)

>d2xr8c1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records): (download)

>d2xr8c1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

SCOPe Domain Coordinates for d2xr8c1:

Click to download the PDB-style file with coordinates for d2xr8c1.
(The format of our PDB-style files is described here.)

Timeline for d2xr8c1: