Lineage for d2xqbl1 (2xqb L:5-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766259Domain d2xqbl1: 2xqb L:5-107 [198611]
    Other proteins in same PDB: d2xqba_, d2xqbl2
    automated match to d1adql1
    complexed with so4

Details for d2xqbl1

PDB Entry: 2xqb (more details), 2.6 Å

PDB Description: crystal structure of anti-il-15 antibody in complex with human il-15
PDB Compounds: (L:) anti-il-15 antibody

SCOPe Domain Sequences for d2xqbl1:

Sequence, based on SEQRES records: (download)

>d2xqbl1 b.1.1.0 (L:5-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqppsasgtpgqrvtiscsgstsnlkrnyvywyqqlpgtapklliyrdrrrpsgvpdrfs
gsksgtsaslaisglrsedeadyycawydrelsewvfgggtkltvl

Sequence, based on observed residues (ATOM records): (download)

>d2xqbl1 b.1.1.0 (L:5-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqppsasgtpgqrvtiscsgstnyvywyqqlpgtapklliyrdrrrpsgvpdrfsgsksg
tsaslaisglrsedeadyycawydrelsewvfgggtkltvl

SCOPe Domain Coordinates for d2xqbl1:

Click to download the PDB-style file with coordinates for d2xqbl1.
(The format of our PDB-style files is described here.)

Timeline for d2xqbl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xqbl2
View in 3D
Domains from other chains:
(mouse over for more information)
d2xqba_