Lineage for d2xhyc_ (2xhy C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (93 species)
    not a true protein
  7. 2418988Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 2419039Domain d2xhyc_: 2xhy C: [198608]
    automated match to d2xhyb_
    complexed with br, so4

Details for d2xhyc_

PDB Entry: 2xhy (more details), 2.3 Å

PDB Description: Crystal Structure of E.coli BglA
PDB Compounds: (C:) 6-phospho-beta-glucosidase bgla

SCOPe Domain Sequences for d2xhyc_:

Sequence, based on SEQRES records: (download)

>d2xhyc_ c.1.8.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgkyypnh
eavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfdellky
niepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfneinnq
rnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgcmlam
vplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgdldvl
regtcdylgfsyymtnavkaeggtgdaisgfegsvpnpyvkasdwgwqidpvglryalce
lyeryqrplfivengfgaydkveedgsinddyridylrahieemkkavtydgvdlmgytp
wgcidcvsfttgqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl

Sequence, based on observed residues (ATOM records): (download)

>d2xhyc_ c.1.8.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgkyypnh
eavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfdellky
niepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfneinnq
rnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgcmlam
vplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgdldvl
regtcdylgfsyymtnavkaegggsvpnpyvkasdwgwqidpvglryalcelyeryqrpl
fivengfgaydkveedgsinddyridylrahieemkkavtydgvdlmgytpwgcidcvsf
ttgqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl

SCOPe Domain Coordinates for d2xhyc_:

Click to download the PDB-style file with coordinates for d2xhyc_.
(The format of our PDB-style files is described here.)

Timeline for d2xhyc_: