Lineage for d2xfxa2 (2xfx A:182-277)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764925Species Cow (Bos taurus) [TaxId:9913] [226022] (4 PDB entries)
  8. 1764930Domain d2xfxa2: 2xfx A:182-277 [198605]
    Other proteins in same PDB: d2xfxa1, d2xfxb_
    automated match to d1a9ea1

Details for d2xfxa2

PDB Entry: 2xfx (more details), 1.9 Å

PDB Description: cattle MHC class I N01301 presenting an 11mer from Theileria parva
PDB Compounds: (A:) MHC class 1

SCOPe Domain Sequences for d2xfxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xfxa2 b.1.1.0 (A:182-277) automated matches {Cow (Bos taurus) [TaxId: 9913]}
adppkahvtrhpssehevtlrcwalgfypeeisltwqrngedqtqdmelvetrpsgdgnf
qkwaalvvpsgeeqrytcrvqheglqepltlrwepg

SCOPe Domain Coordinates for d2xfxa2:

Click to download the PDB-style file with coordinates for d2xfxa2.
(The format of our PDB-style files is described here.)

Timeline for d2xfxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xfxa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2xfxb_