SCOPe 2.03: Domain d2xfxa2: 2xfx A:182-277

Lineage for d2xfxa2 (2xfx A:182-277)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226022] (3 PDB entries)

8. Domain d2xfxa2: 2xfx A:182-277 [198605]
   Other proteins in same PDB: d2xfxa1, d2xfxb_
   automated match to d1a9ea1

Details for d2xfxa2

PDB Entry: 2xfx, 1.9 Å

PDB Description: cattle MHC class I N01301 presenting an 11mer from Theileria parva

PDB Compounds: (A:) MHC class 1

SCOPe Domain Sequences for d2xfxa2:

Sequence; same for both SEQRES and ATOM records:

>d2xfxa2 b.1.1.0 (A:182-277) automated matches {Cow (Bos taurus) [TaxId: 9913]}
adppkahvtrhpssehevtlrcwalgfypeeisltwqrngedqtqdmelvetrpsgdgnf
qkwaalvvpsgeeqrytcrvqheglqepltlrwepg

Timeline for d2xfxa2:

• d2xfxa2 is new in SCOPe 2.03-stable
  
• d2xfxa2 appears in SCOPe 2.04
  
• d2xfxa2 appears in the current release, SCOPe 2.08