| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (23 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226022] (3 PDB entries) |
| Domain d2xfxa2: 2xfx A:182-277 [198605] Other proteins in same PDB: d2xfxa1, d2xfxb_ automated match to d1a9ea1 |
PDB Entry: 2xfx (more details), 1.9 Å
SCOPe Domain Sequences for d2xfxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xfxa2 b.1.1.0 (A:182-277) automated matches {Cow (Bos taurus) [TaxId: 9913]}
adppkahvtrhpssehevtlrcwalgfypeeisltwqrngedqtqdmelvetrpsgdgnf
qkwaalvvpsgeeqrytcrvqheglqepltlrwepg
Timeline for d2xfxa2: