Lineage for d2xfxa2 (2xfx A:182-276)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754143Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries)
  8. 2754148Domain d2xfxa2: 2xfx A:182-276 [198605]
    Other proteins in same PDB: d2xfxa1, d2xfxa3, d2xfxb_
    automated match to d1a9ea1

Details for d2xfxa2

PDB Entry: 2xfx (more details), 1.9 Å

PDB Description: cattle MHC class I N01301 presenting an 11mer from Theileria parva
PDB Compounds: (A:) MHC class 1

SCOPe Domain Sequences for d2xfxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xfxa2 b.1.1.0 (A:182-276) automated matches {Cow (Bos taurus) [TaxId: 9913]}
adppkahvtrhpssehevtlrcwalgfypeeisltwqrngedqtqdmelvetrpsgdgnf
qkwaalvvpsgeeqrytcrvqheglqepltlrwep

SCOPe Domain Coordinates for d2xfxa2:

Click to download the PDB-style file with coordinates for d2xfxa2.
(The format of our PDB-style files is described here.)

Timeline for d2xfxa2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2xfxb_