Lineage for d2xfxa1 (2xfx A:1-181)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2507461Protein automated matches [191280] (4 species)
    not a true protein
  7. 2507465Species Cow (Bos taurus) [TaxId:9913] [225910] (2 PDB entries)
  8. 2507466Domain d2xfxa1: 2xfx A:1-181 [198604]
    Other proteins in same PDB: d2xfxa2, d2xfxa3, d2xfxb_
    automated match to d1xh3a2

Details for d2xfxa1

PDB Entry: 2xfx (more details), 1.9 Å

PDB Description: cattle MHC class I N01301 presenting an 11mer from Theileria parva
PDB Compounds: (A:) MHC class 1

SCOPe Domain Sequences for d2xfxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xfxa1 d.19.1.1 (A:1-181) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gshslryfhtavsrpglreplfitvgyvddtqfvrfdsdardprteprqpwmekegpeyw
dretqiskenalwyrealnnlrgyynqseagshtlqemygcdvgsdgrlrrgyeqygydg
rdylalnedlrswtaadtaaqiskrkmeaagaaerfrnylegtcvewlrrylengkdtll
r

SCOPe Domain Coordinates for d2xfxa1:

Click to download the PDB-style file with coordinates for d2xfxa1.
(The format of our PDB-style files is described here.)

Timeline for d2xfxa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2xfxb_