Lineage for d2xcmb_ (2xcm B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667396Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1667572Protein automated matches [190229] (8 species)
    not a true protein
  7. 1667582Species Barley (Hordeum vulgare) [TaxId:4513] [225951] (1 PDB entry)
  8. 1667584Domain d2xcmb_: 2xcm B: [198603]
    Other proteins in same PDB: d2xcmc_, d2xcmd_
    automated match to d3qdda_
    complexed with adp, mg, zn

Details for d2xcmb_

PDB Entry: 2xcm (more details), 2.2 Å

PDB Description: complex of hsp90 n-terminal, sgt1 cs and rar1 chord2 domain
PDB Compounds: (B:) cytosolic heat shock protein 90

SCOPe Domain Sequences for d2xcmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xcmb_ d.122.1.1 (B:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
hhaaatetetfafqaeinqllsliintfysnkeiflrelisnssdaldkirfesltdksk
ldaqpelfihiipdkatstltivdsgigmtksdlvnnlgtiarsgtkefmealaagadvs
migqfgvgfysaylvaervvvttkhnddeqyvwesqaggsftvtrdtsgeqlgrgtkmvl
ylkddqmeyleerrikdlvkkhsefisypislw

SCOPe Domain Coordinates for d2xcmb_:

Click to download the PDB-style file with coordinates for d2xcmb_.
(The format of our PDB-style files is described here.)

Timeline for d2xcmb_: