Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
Protein automated matches [190229] (13 species) not a true protein |
Species Barley (Hordeum vulgare) [TaxId:4513] [225951] (1 PDB entry) |
Domain d2xcma1: 2xcm A:2-210 [198602] Other proteins in same PDB: d2xcma2, d2xcmb2, d2xcmc_, d2xcmd_ automated match to d3qdda_ complexed with adp, mg, zn |
PDB Entry: 2xcm (more details), 2.2 Å
SCOPe Domain Sequences for d2xcma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xcma1 d.122.1.1 (A:2-210) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} atetetfafqaeinqllsliintfysnkeiflrelisnssdaldkirfesltdkskldaq pelfihiipdkatstltivdsgigmtksdlvnnlgtiarsgtkefmealaagadvsmigq fgvgfysaylvaervvvttkhnddeqyvwesqaggsftvtrdtsgeqlgrgtkmvlylkd dqmeyleerrikdlvkkhsefisypislw
Timeline for d2xcma1:
View in 3D Domains from other chains: (mouse over for more information) d2xcmb1, d2xcmb2, d2xcmc_, d2xcmd_ |