Lineage for d2x9ca_ (2x9c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690748Superfamily a.2.20: MxiH-like [140129] (2 families) (S)
    Type III secretion system needle
  5. 2690759Family a.2.20.0: automated matches [193724] (1 protein)
    not a true family
  6. 2690760Protein automated matches [193725] (2 species)
    not a true protein
  7. 2690761Species Salmonella typhimurium [TaxId:216597] [193726] (3 PDB entries)
  8. 2690762Domain d2x9ca_: 2x9c A: [198601]
    automated match to d2x9cb_
    mutant

Details for d2x9ca_

PDB Entry: 2x9c (more details), 2.45 Å

PDB Description: crystal structure of a soluble prgi mutant from salmonella typhimurium
PDB Compounds: (A:) Protein prgI

SCOPe Domain Sequences for d2x9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x9ca_ a.2.20.0 (A:) automated matches {Salmonella typhimurium [TaxId: 216597]}
gvdnlqtqvtealdklaakpsdpallaayqsklseynlyrnaqsntakafkdidaaiiqn
fr

SCOPe Domain Coordinates for d2x9ca_:

Click to download the PDB-style file with coordinates for d2x9ca_.
(The format of our PDB-style files is described here.)

Timeline for d2x9ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2x9cb_