| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.20: MxiH-like [140129] (2 families) ![]() Type III secretion system needle |
| Family a.2.20.0: automated matches [193724] (1 protein) not a true family |
| Protein automated matches [193725] (2 species) not a true protein |
| Species Salmonella typhimurium [TaxId:216597] [193726] (3 PDB entries) |
| Domain d2x9ca_: 2x9c A: [198601] automated match to d2x9cb_ mutant |
PDB Entry: 2x9c (more details), 2.45 Å
SCOPe Domain Sequences for d2x9ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x9ca_ a.2.20.0 (A:) automated matches {Salmonella typhimurium [TaxId: 216597]}
gvdnlqtqvtealdklaakpsdpallaayqsklseynlyrnaqsntakafkdidaaiiqn
fr
Timeline for d2x9ca_: