| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
| Domain d2x1pc1: 2x1p C:6-126 [198599] Other proteins in same PDB: d2x1pa2, d2x1pb2, d2x1pc2, d2x1pd2 automated match to d2x1pd_ |
PDB Entry: 2x1p (more details), 1.1 Å
SCOPe Domain Sequences for d2x1pc1:
Sequence, based on SEQRES records: (download)
>d2x1pc1 b.1.1.1 (C:6-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrtftsfamgwfrqapgkerefvasisrsgtltryadsak
grftisvdnakntvslqmdnlnpddtavyycaadlhrpygpgtqrsdeydswgqgtqvtv
s
>d2x1pc1 b.1.1.1 (C:6-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasfamgwfrqapgkerefvasisrsgtltryadsakgrftis
vdnakntvslqmdnlnpddtavyycaadlhrpygpgtqrsdeydswgqgtqvtvs
Timeline for d2x1pc1: